PDB entry 2apt

View 2apt on RCSB PDB site
Description: Crystal Structure of the G17E/S54N/K66E/Q72H/E80V/L81S/T87S/G96V variant of the murine T cell receptor V beta 8.2 domain
Class: Immune system
Keywords: the murine T cell receptor V beta 8.2 domain, Immune system
Deposited on 2005-08-16, released 2006-03-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell receptor beta chain V
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2apta_
  • Chain 'B':
    Compound: T-cell receptor beta chain V
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2aptb_
  • Heterogens: MLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2aptA (A:)
ileaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagntekg
dipdgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl

    Sequence, based on observed residues (ATOM records): (download) 
    >2aptA (A:)
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagntekgdip
dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2aptB (B:)
ileaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagntekg
dipdgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl

    Sequence, based on observed residues (ATOM records): (download) 
    >2aptB (B:)
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagntekgdip
dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl