PDB entry 2apl

View 2apl on RCSB PDB site
Description: Crystal structure of protein PG0816 from Porphyromonas gingivalis
Class: Structural genomics, unknown function
Keywords: Structural genomics, Porphyromonas gingivalis, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2005-08-16, released 2005-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.199
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PG0816
    Species: Porphyromonas gingivalis [TaxId:242619]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MW33
      • modified residue (26)
      • modified residue (60)
    Domains in SCOPe 2.08: d2apla1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2aplA (A:)
mkstekkelshfrlkletylnehfpemsgnnpfitarsdealtaycdavaqgfshpeaes
masevlyqglhfsrydtlvsvlerefeqelpsplperlapillknkaiqsvfakydltdd
feaspeyehlyteltgtivlliesnhlptigggndtv

    Sequence, based on observed residues (ATOM records): (download) 
    >2aplA (A:)
kstekkelshfrlkletylnehfpemsgnnpfitarsdealtaycdavaqgfshpeaesm
asevlyqglhfsrydtlvsvlerefeqelpsplperlapillknkaiqsvfakydltddf
easpeyehlyteltgtivlliesnhlpti