PDB entry 2apj

View 2apj on RCSB PDB site
Description: X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution
Class: structural genomics, unknown function
Keywords: AT4G34215, Putative Esterase,SGNH-HYDROLASE SUPERFAMILY, CARBOHYDRATE ESTERASE FAMILY 6, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, CESG, Center for Eukaryotic Structural Genomics
Deposited on 2005-08-16, released 2005-08-30
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-04, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.147
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative Esterase
    Species: Arabidopsis thaliana
    Gene: AT4G34215
    Database cross-references and differences (RAF-indexed):
    • Uniprot O49483 (Start-259)
      • modified residue (30)
    Domains in SCOP 1.73: d2apja1
  • Chain 'B':
    Compound: Putative Esterase
    Species: Arabidopsis thaliana
    Gene: AT4G34215
    Database cross-references and differences (RAF-indexed):
    • Uniprot O49483 (Start-259)
      • modified residue (30)
    Domains in SCOP 1.73: d2apjb1
  • Chain 'C':
    Compound: Putative Esterase
    Species: Arabidopsis thaliana
    Gene: AT4G34215
    Database cross-references and differences (RAF-indexed):
    • Uniprot O49483 (Start-259)
      • modified residue (30)
    Domains in SCOP 1.73: d2apjc1
  • Chain 'D':
    Compound: Putative Esterase
    Species: Arabidopsis thaliana
    Gene: AT4G34215
    Database cross-references and differences (RAF-indexed):
    • Uniprot O49483 (Start-259)
      • modified residue (30)
    Domains in SCOP 1.73: d2apjd1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2apjA (A:)
    meggsitpgedkpeiqspippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecap
    nssilrlsadlrweeaheplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcas
    ggtaikewergshlyermvkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrl
    iknlrhdlnlpslpiiqvaiasgggyidkvreaqlglklsnvvcvdakglplksdnlhlt
    teaqvqlglslaqaylsnfc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2apjA (A:)
    spippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecapnssilrlsadlrweea
    heplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcasggtaikewergshlye
    rmvkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrliknlrhdlnlpslpii
    qvaiasgggyidkvreaqlglklsnvvcvdakglplksdnlhltteaqvqlglslaqayl
    snfc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2apjB (B:)
    meggsitpgedkpeiqspippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecap
    nssilrlsadlrweeaheplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcas
    ggtaikewergshlyermvkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrl
    iknlrhdlnlpslpiiqvaiasgggyidkvreaqlglklsnvvcvdakglplksdnlhlt
    teaqvqlglslaqaylsnfc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2apjB (B:)
    pippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecapnssilrlsadlrweeah
    eplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcasggtaikewergshlyer
    mvkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrliknlrhdlnlpslpiiq
    vaiasgggyidkvreaqlglklsnvvcvdakglplksdnlhltteaqvqlglslaqayls
    nfc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2apjC (C:)
    meggsitpgedkpeiqspippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecap
    nssilrlsadlrweeaheplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcas
    ggtaikewergshlyermvkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrl
    iknlrhdlnlpslpiiqvaiasgggyidkvreaqlglklsnvvcvdakglplksdnlhlt
    teaqvqlglslaqaylsnfc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2apjC (C:)
    ppnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecapnssilrlsadlrweeahep
    lhvdidtgkvcgvgpgmafanavknrletdsaviglvpcasggtaikewergshlyermv
    krteesrkcggeikavlwyqgesdvldihdaesygnnmdrliknlrhdlnlpslpiiqva
    iasgggyidkvreaqlglklsnvvcvdakglplksdnlhltteaqvqlglslaqaylsnf
    c
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2apjD (D:)
    meggsitpgedkpeiqspippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecap
    nssilrlsadlrweeaheplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcas
    ggtaikewergshlyermvkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrl
    iknlrhdlnlpslpiiqvaiasgggyidkvreaqlglklsnvvcvdakglplksdnlhlt
    teaqvqlglslaqaylsnfc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2apjD (D:)
    ppnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecapnssilrlsadlrweeahep
    lhvdidtgkvcgvgpgmafanavknrlsaviglvpcasggtaikewergshlyermvkrt
    eesrkcggeikavlwyqgesdvldihdaesygnnmdrliknlrhdlnlpslpiiqvaias
    gggyidkvreaqlglklsnvvcvdakglplksdnlhltteaqvqlglslaqaylsnfc