PDB entry 2aph

View 2aph on RCSB PDB site
Description: Crystal structure of human PGRP-IalphaC in complex with muramyl pentapeptide
Class: immune system
Keywords: PGRPs, Lys-type, peptidoglycan, complex, IMMUNE SYSTEM
Deposited on 2005-08-16, released 2006-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidoglycan recognition protein I-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PGLYRP3, PGRPIA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2apha_
  • Chain 'B':
    Compound: Peptidoglycan recognition protein I-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PGLYRP3, PGRPIA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2aphb_
  • Chain 'C':
    Compound: muramyl pentapeptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2APH
  • Chain 'D':
    Compound: muramyl pentapeptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2APH (0-End)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aphA (A:)
    vcpniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrn
    fcdigyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqd
    liqcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aphB (B:)
    vcpniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrn
    fcdigyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqd
    liqcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.