PDB entry 2apb

View 2apb on RCSB PDB site
Description: Crystal Structure of the S54N variant of murine T cell receptor Vbeta 8.2 domain
Class: immune system
Keywords: T cell receptor, immune system
Deposited on 2005-08-16, released 2006-03-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell receptor beta chain V
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2apba_
  • Heterogens: MLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2apbA (A:)
eaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagntekgdi
pdgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl