PDB entry 2ap9

View 2ap9 on RCSB PDB site
Description: Crystal structure of acetylglutamate kinase from Mycobacterium tuberculosis CDC1551
Class: signaling protein,transferase
Keywords: Structural Genomics; Protein Structure Initiative; NYSGXRC; T1702; acetylglutamate kinase; PSI; New York Structural GenomiX Research Consortium
Deposited on 2005-08-15, released 2005-08-30
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.258
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylglutamate kinase
    Species: Mycobacterium tuberculosis CDC1551
    Gene: argB, Rv1654, MT1692
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4Y6 (0-290)
      • modified residue (36)
      • modified residue (49)
      • modified residue (72)
      • modified residue (99)
      • modified residue (161)
      • modified residue (207)
      • conflict (242)
      • modified residue (244)
      • his tag (291-298)
    Domains in SCOP 1.73: d2ap9a1
  • Chain 'B':
    Compound: acetylglutamate kinase
    Species: Mycobacterium tuberculosis CDC1551
    Gene: argB, Rv1654, MT1692
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4Y6 (0-290)
      • modified residue (36)
      • modified residue (49)
      • modified residue (72)
      • modified residue (99)
      • modified residue (161)
      • modified residue (207)
      • conflict (242)
      • modified residue (244)
      • his tag (291)
    Domains in SCOP 1.73: d2ap9b1
  • Chain 'C':
    Compound: acetylglutamate kinase
    Species: Mycobacterium tuberculosis CDC1551
    Gene: argB, Rv1654, MT1692
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4Y6 (0-290)
      • modified residue (36)
      • modified residue (49)
      • modified residue (72)
      • modified residue (99)
      • modified residue (161)
      • modified residue (207)
      • conflict (242)
      • modified residue (244)
      • his tag (291)
    Domains in SCOP 1.73: d2ap9c1
  • Chain 'D':
    Compound: acetylglutamate kinase
    Species: Mycobacterium tuberculosis CDC1551
    Gene: argB, Rv1654, MT1692
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4Y6 (0-290)
      • modified residue (36)
      • modified residue (49)
      • modified residue (72)
      • modified residue (99)
      • modified residue (161)
      • modified residue (207)
      • conflict (242)
      • modified residue (244)
      • his tag (291)
    Domains in SCOP 1.73: d2ap9d1
  • Chain 'E':
    Compound: acetylglutamate kinase
    Species: Mycobacterium tuberculosis CDC1551
    Gene: argB, Rv1654, MT1692
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4Y6 (0-290)
      • modified residue (36)
      • modified residue (49)
      • modified residue (72)
      • modified residue (99)
      • modified residue (161)
      • modified residue (207)
      • conflict (242)
      • modified residue (244)
      • his tag (291-294)
    Domains in SCOP 1.73: d2ap9e1
  • Chain 'F':
    Compound: acetylglutamate kinase
    Species: Mycobacterium tuberculosis CDC1551
    Gene: argB, Rv1654, MT1692
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4Y6 (0-290)
      • modified residue (36)
      • modified residue (49)
      • modified residue (72)
      • modified residue (99)
      • modified residue (161)
      • modified residue (207)
      • conflict (242)
      • modified residue (244)
      • his tag (291)
    Domains in SCOP 1.73: d2ap9f1
  • Heterogens: MG, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ap9A (A:)
    iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp
    vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy
    avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd
    adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt
    lelgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrgeghhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ap9B (B:)
    iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp
    vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy
    avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd
    adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt
    lelgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ap9B (B:)
    iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp
    vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy
    avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd
    adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt
    lelgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ap9C (C:)
    iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp
    vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy
    avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd
    adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt
    lelgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ap9C (C:)
    iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp
    vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy
    avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd
    adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt
    lelgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ap9D (D:)
    iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp
    vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy
    avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd
    adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt
    lelgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ap9D (D:)
    iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp
    vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy
    avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd
    adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt
    lelgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrge
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ap9E (E:)
    iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp
    vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy
    avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd
    adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt
    lelgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ap9E (E:)
    iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp
    vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy
    avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd
    adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt
    lelgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrgeghh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ap9F (F:)
    iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp
    vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy
    avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd
    adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt
    lelgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ap9F (F:)
    iealpthikaqvlaealpwlkqlhgkvvvvkyggnamtddtlrrafaadmaflrncgihp
    vvvhgggpqitamlrrlgiegdfkggfrvttpevldvarmvlfgqvgrelvnlinahgpy
    avgitgedaqlftavrrsvtvdgvatdiglvgdvdqvntaamldlvaagripvvstlapd
    adgvvhninadtaaaavaealgaekllmltdidglytrwpdrdslvseidtgtlaqllpt
    lelgmvpkveaclraviggvpsahiidgrvthcvlvelftdagtgtkvvrge