PDB entry 2ap6

View 2ap6 on RCSB PDB site
Description: X-Ray Crystal Structure of Protein Atu4242 from Agrobacterium tumefaciens. Northeast Strucutral Genomics Consortium Target AtR43.
Class: unknown function
Keywords: structural genomics, psi, protein structure initiative, northeast structural genomics consortium, nesg, unknown function
Deposited on 2005-08-15, released 2005-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.197
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Atu4242
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: Atu4242
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U857 (0-102)
      • modified residue (0)
      • modified residue (70)
      • modified residue (94)
      • cloning artifact (103)
    Domains in SCOPe 2.08: d2ap6a1, d2ap6a2
  • Chain 'B':
    Compound: hypothetical protein Atu4242
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: Atu4242
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U857 (0-102)
      • modified residue (0)
      • modified residue (70)
      • modified residue (94)
      • cloning artifact (103)
    Domains in SCOPe 2.08: d2ap6b2, d2ap6b3
  • Chain 'C':
    Compound: hypothetical protein Atu4242
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: Atu4242
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U857 (0-102)
      • modified residue (0)
      • modified residue (70)
      • modified residue (94)
      • cloning artifact (103)
    Domains in SCOPe 2.08: d2ap6c2, d2ap6c3
  • Chain 'D':
    Compound: hypothetical protein Atu4242
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: Atu4242
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U857 (0-102)
      • modified residue (0)
      • modified residue (70)
      • modified residue (94)
      • cloning artifact (103)
    Domains in SCOPe 2.08: d2ap6d2, d2ap6d3
  • Chain 'E':
    Compound: hypothetical protein Atu4242
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: Atu4242
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U857 (0-102)
      • modified residue (0)
      • modified residue (70)
      • modified residue (94)
      • cloning artifact (103)
    Domains in SCOPe 2.08: d2ap6e2, d2ap6e3
  • Chain 'F':
    Compound: hypothetical protein Atu4242
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: Atu4242
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U857 (0-102)
      • modified residue (0)
      • modified residue (70)
      • modified residue (94)
      • cloning artifact (103)
    Domains in SCOPe 2.08: d2ap6f2, d2ap6f3
  • Chain 'G':
    Compound: hypothetical protein Atu4242
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: Atu4242
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U857 (0-102)
      • modified residue (0)
      • modified residue (70)
      • modified residue (94)
      • cloning artifact (103)
    Domains in SCOPe 2.08: d2ap6g2, d2ap6g3
  • Chain 'H':
    Compound: hypothetical protein Atu4242
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: Atu4242
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U857 (0-102)
      • modified residue (0)
      • modified residue (70)
      • modified residue (94)
      • cloning artifact (103)
    Domains in SCOPe 2.08: d2ap6h2, d2ap6h3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ap6A (A:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplmlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ap6A (A:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ap6B (B:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplmlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ap6B (B:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ap6C (C:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplmlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ap6C (C:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ap6D (D:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplmlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ap6D (D:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ap6E (E:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplmlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ap6E (E:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ap6F (F:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplmlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ap6F (F:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ap6G (G:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplmlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ap6G (G:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplm
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ap6H (H:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplmlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ap6H (H:)
    mfyeirtyrlkngaipaylkvvedegieiqkshlgelvgyffseigpineivhiwafssl
    ddraerrarlmadprwlsflpkirdlievaenkimkparfsplm