PDB entry 2aow

View 2aow on RCSB PDB site
Description: Histamine Methyltransferase (Natural Variant I105) Complexed with the Acetylcholinesterase Inhibitor and Altzheimer's Disease Drug Tacrine
Class: transferase
Keywords: classic methyltransferase fold, protein-drug complex
Deposited on 2005-08-14, released 2005-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: 0.219
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histamine N-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: HNMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50135 (Start-291)
      • engineered (104)
    Domains in SCOPe 2.08: d2aowa_
  • Chain 'B':
    Compound: Histamine N-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: HNMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50135 (Start-291)
      • engineered (104)
    Domains in SCOPe 2.08: d2aowb_
  • Heterogens: THA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aowA (A:)
    massmrslfsdhgkyvesfrrflnhstehqcmqefmdkklpgiigrigdtkseikilsig
    ggageidlqilskvqaqypgvcinnevvepsaeqiakykelvakisnlenvkfawhkets
    seyqsrmlekkelqkwdfihmiqmlyyvkdipatlkffhsllgtnakmliivvsgssgwd
    klwkkygsrfpqddlcqyitsddltqmldnlglkyecydllstmdisdcfidgnengdll
    wdfltetcnfnatappdlraelgkdlqepefsakkegkvlfnntlsfiviea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aowA (A:)
    mrslfsdhgkyvesfrrflnhstehqcmqefmdkklpgiigrigdtkseikilsigggag
    eidlqilskvqaqypgvcinnevvepsaeqiakykelvakisnlenvkfawhketsseyq
    srmlekkelqkwdfihmiqmlyyvkdipatlkffhsllgtnakmliivvsgssgwdklwk
    kygsrfpqddlcqyitsddltqmldnlglkyecydllstmdisdcfidgnengdllwdfl
    tetcnfnatappdlraelgkdlqepefsakkegkvlfnntlsfiviea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aowB (B:)
    massmrslfsdhgkyvesfrrflnhstehqcmqefmdkklpgiigrigdtkseikilsig
    ggageidlqilskvqaqypgvcinnevvepsaeqiakykelvakisnlenvkfawhkets
    seyqsrmlekkelqkwdfihmiqmlyyvkdipatlkffhsllgtnakmliivvsgssgwd
    klwkkygsrfpqddlcqyitsddltqmldnlglkyecydllstmdisdcfidgnengdll
    wdfltetcnfnatappdlraelgkdlqepefsakkegkvlfnntlsfiviea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aowB (B:)
    mrslfsdhgkyvesfrrflnhstehqcmqefmdkklpgiigrigdtkseikilsigggag
    eidlqilskvqaqypgvcinnevvepsaeqiakykelvakisnlenvkfawhketsseyq
    srmlekkelqkwdfihmiqmlyyvkdipatlkffhsllgtnakmliivvsgssgwdklwk
    kygsrfpqddlcqyitsddltqmldnlglkyecydllstmdisdcfidgnengdllwdfl
    tetcnfnatappdlraelgkdlqepefsakkegkvlfnntlsfiviea