PDB entry 2aoj

View 2aoj on RCSB PDB site
Description: Crystal structure analysis of HIV-1 protease with a substrate analog P6-PR
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, mutant, dimer, substrate analog, hydrolase-hydrolase inhibitor complex
Deposited on 2005-08-12, released 2006-01-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.152
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11682]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOPe 2.05: d2aoja_
• Chain 'B':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11682]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOPe 2.05: d2aojb_
• Chain 'C':
  Compound: peptide inhibitor
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2AOJ (0-End)
• Heterogens: DMS, ACY, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aojA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aojB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'C':
  No sequence available.