PDB entry 2aog

View 2aog on RCSB PDB site
Description: Crystal structure analysis of HIV-1 protease mutant V82A with a substrate analog P2-NC
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, mutant, dimer, substrate analog, hydrolase-hydrolase inhibitor complex
Deposited on 2005-08-12, released 2006-01-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.13
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease (retropepsin)
    Species: Human immunodeficiency virus 1 [TaxId:11682]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (81)
      • engineered (94)
    Domains in SCOPe 2.06: d2aoga_
  • Chain 'B':
    Compound: hiv-1 protease (retropepsin)
    Species: Human immunodeficiency virus 1 [TaxId:11682]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (81)
      • engineered (94)
    Domains in SCOPe 2.06: d2aogb_
  • Heterogens: 2NC, UNX, GOL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aogA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aogB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf