PDB entry 2aof
View 2aof on RCSB PDB site
Description: Crystal structure analysis of HIV-1 Protease mutant V82A with a substrate analog P1-P6
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, mutant, dimer, substrate analog, hydrolase-hydrolase inhibitor complex
Deposited on
2005-08-12, released
2006-01-17
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.134
AEROSPACI score: 0.77
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587
- engineered (6)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (81)
- engineered (94)
Domains in SCOPe 2.04: d2aofa_ - Chain 'B':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- engineered (6)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (81)
- engineered (94)
Domains in SCOPe 2.04: d2aofb_ - Chain 'C':
Compound: peptide inhibitor
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: NA, CL, ACY, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2aofA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2aofB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
- Chain 'C':
No sequence available.