PDB entry 2aof

View 2aof on RCSB PDB site
Description: Crystal structure analysis of HIV-1 Protease mutant V82A with a substrate analog P1-P6
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, mutant, dimer, substrate analog, hydrolase-hydrolase inhibitor complex
Deposited on 2005-08-12, released 2006-01-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.134
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (81)
      • engineered (94)
    Domains in SCOPe 2.04: d2aofa_
  • Chain 'B':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (62)
      • engineered (66)
      • engineered (81)
      • engineered (94)
    Domains in SCOPe 2.04: d2aofb_
  • Chain 'C':
    Compound: peptide inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2AOF (0-End)
  • Heterogens: NA, CL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aofA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aofB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
    

  • Chain 'C':
    No sequence available.