PDB entry 2aoe

View 2aoe on RCSB PDB site
Description: crystal structure analysis of HIV-1 protease mutant V82A with a substrate analog CA-P2
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, substrate analog, hydrolase-hydrolase inhibitor complex
Deposited on 2005-08-12, released 2006-01-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.134
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus type 1 (BH5 ISOLATE) [TaxId:11682]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (81)
    • engineered (94)
  Domains in SCOPe 2.04: d2aoea_
• Chain 'B':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus type 1 (BH5 ISOLATE) [TaxId:11682]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (62)
    • engineered (66)
    • engineered (81)
    • engineered (94)
  Domains in SCOPe 2.04: d2aoeb_
• Heterogens: NA, CL, DMS, ACY, GOL, 0Q4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aoeA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aoeB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf