PDB entry 2aoc

View 2aoc on RCSB PDB site
Description: Crystal structure analysis of HIV-1 protease mutant I84V with a substrate analog P2-NC
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 PROTEASE, MUTANT, DIMER, SUBSTRATE ANALOG, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2005-08-12, released 2006-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.126
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1 (BH5 ISOLATE) [TaxId:11682]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (83)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d2aoca_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1 (BH5 ISOLATE) [TaxId:11682]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (83)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d2aocb_
  • Heterogens: UNX, NA, CL, DMS, GOL, 2NC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aocA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aocB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvnvigrnlltqigatlnf