PDB entry 2aob

View 2aob on RCSB PDB site
Description: Crystal structures of a high-affinity macrocyclic peptide mimetic in complex with the Grb2 SH2 domain
Class: transferase
Keywords: Grb2 SH2, peptide mimetic, domain swapping, Kinase signalling, TRANSFERASE
Deposited on 2005-08-12, released 2005-10-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.235
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2aoba_
  • Chain 'B':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2aobb_
  • Chain 'C':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2aobc_
  • Chain 'D':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2aobd_
  • Heterogens: S1S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aobA (A:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aobA (A:)
    kphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
    gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aobB (B:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aobB (B:)
    pwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagky
    flwvvkfnslnelvdyhrstsvsrnqqiflrdi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aobC (C:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aobC (C:)
    kphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
    gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2aobD (D:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aobD (D:)
    pwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagky
    flwvvkfnslnelvdyhrstsvsrnqqiflrdi