PDB entry 2aoa

View 2aoa on RCSB PDB site
Description: Crystal structures of a high-affinity macrocyclic peptide mimetic in complex with the Grb2 SH2 domain
Class: transferase
Keywords: Grb2 SH2, domain-swapped, peptide mimetic, TRANSFERASE
Deposited on 2005-08-12, released 2005-10-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.249
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2aoaa_
  • Chain 'B':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2aoab_
  • Heterogens: S1S, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aoaA (A:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aoaA (A:)
    hpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagk
    yflwvvkfnslnelvdyhrstsvsrnqqiflrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aoaB (B:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aoaB (B:)
    akaeemlskqrhdgafliregdfslsvkfgndvqhfkvlrdgagkyflwvvkfnslnelv
    dyhrstsvsrnqqiflr