PDB entry 2ao9

View 2ao9 on RCSB PDB site
Description: Structural Genomics, The crystal structure of a Phage protein (phBC6A51) from Bacillus cereus ATCC 14579
Class: structural genomics, unknown function
Keywords: Structural genomics, nine-fold NCS., PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-08-12, released 2005-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phage protein
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ao9a1
  • Chain 'B':
    Compound: Phage protein
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ao9b_
  • Chain 'C':
    Compound: Phage protein
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ao9c_
  • Chain 'D':
    Compound: Phage protein
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ao9d_
  • Chain 'E':
    Compound: Phage protein
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ao9e_
  • Chain 'F':
    Compound: Phage protein
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ao9f_
  • Chain 'G':
    Compound: Phage protein
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ao9g_
  • Chain 'H':
    Compound: Phage protein
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ao9h_
  • Chain 'I':
    Compound: Phage protein
    Species: Bacillus cereus [TaxId:226900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ao9i_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ao9A (A:)
    mpfsisgrkgsemmakldelkqkltakqiqaayllvenelmesnneekrtqdemanelgi
    nrttlwewrtknqdfiafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfg
    lltdkkviegdlgnatrtnaeieeqlqklkkltge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ao9A (A:)
    mmakldelkqkltakqiqaayllvenelmeeekrtqdemanelginrttlwewrtknqdf
    iafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ao9B (B:)
    mpfsisgrkgsemmakldelkqkltakqiqaayllvenelmesnneekrtqdemanelgi
    nrttlwewrtknqdfiafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfg
    lltdkkviegdlgnatrtnaeieeqlqklkkltge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ao9B (B:)
    makldelkqkltakqiqaayllvenelmeekrtqdemanelginrttlwewrtknqdfia
    fksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ao9C (C:)
    mpfsisgrkgsemmakldelkqkltakqiqaayllvenelmesnneekrtqdemanelgi
    nrttlwewrtknqdfiafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfg
    lltdkkviegdlgnatrtnaeieeqlqklkkltge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ao9C (C:)
    makldelkqkltakqiqaayllvenelmeseekrtqdemanelginrttlwewrtknqdf
    iafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegdl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ao9D (D:)
    mpfsisgrkgsemmakldelkqkltakqiqaayllvenelmesnneekrtqdemanelgi
    nrttlwewrtknqdfiafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfg
    lltdkkviegdlgnatrtnaeieeqlqklkkltge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ao9D (D:)
    kltakqiqaayllvenelmeeekrtqdemanelginrttlwewrtknqdfiafksevads
    flaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegdl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ao9E (E:)
    mpfsisgrkgsemmakldelkqkltakqiqaayllvenelmesnneekrtqdemanelgi
    nrttlwewrtknqdfiafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfg
    lltdkkviegdlgnatrtnaeieeqlqklkkltge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ao9E (E:)
    makldelkqkltakqiqaayllvenelmeekrtqdemanelginrttlwewrtknqdfia
    fksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegdl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ao9F (F:)
    mpfsisgrkgsemmakldelkqkltakqiqaayllvenelmesnneekrtqdemanelgi
    nrttlwewrtknqdfiafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfg
    lltdkkviegdlgnatrtnaeieeqlqklkkltge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ao9F (F:)
    kldelkqkltakqiqaayllvenelmkrtqdemanelginrttlwewrtknqdfiafkse
    vadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ao9G (G:)
    mpfsisgrkgsemmakldelkqkltakqiqaayllvenelmesnneekrtqdemanelgi
    nrttlwewrtknqdfiafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfg
    lltdkkviegdlgnatrtnaeieeqlqklkkltge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ao9G (G:)
    ltakqiqaayllvenelmeeekrtqdemanelginrttlwewrtknqdfiafksevadsf
    laekreqvysklmqlilgpqpsvkamqlymqrfglltdkkviegdl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ao9H (H:)
    mpfsisgrkgsemmakldelkqkltakqiqaayllvenelmesnneekrtqdemanelgi
    nrttlwewrtknqdfiafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfg
    lltdkkviegdlgnatrtnaeieeqlqklkkltge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ao9H (H:)
    akldelkqkltakqiqaayllvenelmeseekrtqdemanelginrttlwewrtknqdfi
    afksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfglltdkkvieg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ao9I (I:)
    mpfsisgrkgsemmakldelkqkltakqiqaayllvenelmesnneekrtqdemanelgi
    nrttlwewrtknqdfiafksevadsflaekreqvysklmqlilgpqpsvkamqlymqrfg
    lltdkkviegdlgnatrtnaeieeqlqklkkltge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ao9I (I:)
    kltakqiqaayllvenelkrtqdemanelginrttlwewrfiafksevadsflaekreqv
    ysklmqlilgpqpsvkamqlymqrfglltdkkviegdlg