PDB entry 2ao6

View 2ao6 on RCSB PDB site
Description: Crystal structure of the human androgen receptor ligand binding domain bound with TIF2(iii) 740-753 peptide and R1881
Class: transcription
Keywords: crystal structure; human androgen receptor ligand binding domain; transcriptional intermediary factor 2 740-753; r188, transcription
Deposited on 2005-08-12, released 2005-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Ar, Nr3c4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ao6a_
  • Chain 'B':
    Compound: 14-mer fragment of Nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15596
      • insertion (14-24)
  • Heterogens: R18, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ao6A (A:)
    piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
    ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
    sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
    scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
    vkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ao6A (A:)
    piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
    ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
    sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiatscsrrf
    yqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkvkpiyf
    ht
    

  • Chain 'B':
    No sequence available.