PDB entry 2ao2

View 2ao2 on RCSB PDB site
Description: The 2.07 Angstrom crystal structure of Mycobacterium tuberculosis chorismate mutase reveals unexpected gene duplication and suggests a role in host-pathogen interactions
Class: isomerase
Keywords: Chorismate mutase, tryptophan, gene duplication, allostery, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, ISOMERASE
Deposited on 2005-08-12, released 2006-06-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.18
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1885c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ao2a_
  • Chain 'B':
    Compound: chorismate mutase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1885c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ao2b_
  • Chain 'C':
    Compound: chorismate mutase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1885c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ao2c_
  • Heterogens: SO4, TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ao2A (A:)
    gtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyv
    trvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsl
    lsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ao2B (B:)
    gtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyv
    trvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsl
    lsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ao2C (C:)
    gtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyv
    trvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsl
    lsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa