PDB entry 2ao2

View 2ao2 on RCSB PDB site
Description: The 2.07 Angstrom crystal structure of Mycobacterium tuberculosis chorismate mutase reveals unexpected gene duplication and suggests a role in host-pathogen interactions
Class: isomerase
Keywords: Chorismate mutase, tryptophan, gene duplication, allostery, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2005-08-12, released 2006-06-13
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-24, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.18
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Mycobacterium tuberculosis
    Gene: Rv1885c
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ao2a1
  • Chain 'B':
    Compound: chorismate mutase
    Species: Mycobacterium tuberculosis
    Gene: Rv1885c
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ao2b1
  • Chain 'C':
    Compound: chorismate mutase
    Species: Mycobacterium tuberculosis
    Gene: Rv1885c
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ao2c1
  • Heterogens: SO4, TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ao2A (A:)
gtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyv
trvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsl
lsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ao2B (B:)
gtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyv
trvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsl
lsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ao2C (C:)
gtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyv
trvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsl
lsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa