PDB entry 2ao0

View 2ao0 on RCSB PDB site
Description: Structure of Aldehyde Reductase Holoenzyme in Complex with the Potent Aldose Reductase Inhibitor Fidarestat: Implications for Inhibitor Binding and Selectivity
Class: oxidoreductase
Keywords: tim barrel, aldo-keto reductase, ternary complex, oxidoreductase
Deposited on 2005-08-11, released 2005-10-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.209
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50578 (0-323)
      • see remark 999 (59)
      • see remark 999 (269)
    Domains in SCOPe 2.08: d2ao0a_
  • Heterogens: SO4, NAP, FID, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ao0A (A:)
aascvllhtgqkmpliglgtwksepgqvkaaikyaltvgyrhidcaaiygneleigealq
etvgpgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyaferg
dnpfpknadgtirydathykdtwkalealvakglvralglsnfssrqiddvlsvasvrpa
vlqvechpylaqneliahcqarglevtaysplgssdrawrdpnepvlleepvvqalaeky
nrspaqillrwqvqrkvicipksvtpsrilqniqvfdftfspeemkqldalnknlrfivp
mltvdgkrvprdaghplypfndpy