PDB entry 2anz

View 2anz on RCSB PDB site
Description: cytochrome c peroxidase in complex with 2,6-diaminopyridine
Class: oxidoreductase
Keywords: oxidoreductase, peroxidase, model binding site
Deposited on 2005-08-11, released 2006-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.192
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP1, CCP, CPO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (3-293)
      • conflict (52)
      • conflict (151)
      • engineered (190)
      • conflict (271)
    Domains in SCOPe 2.07: d2anza_
  • Heterogens: HEM, 26D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2anzA (A:)
    mktlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2anzA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl