PDB entry 2any

View 2any on RCSB PDB site
Description: Expression, Crystallization and the Three-dimensional Structure of the Catalytic Domain of Human Plasma Kallikrein: Implications for Structure-Based Design of Protease Inhibitors
Class: blood clotting, hydrolase
Keywords: mutagenically deglycosyalted human plasma kallikrein protease domain; trypsin-like serine protease, BLOOD CLOTTING, HYDROLASE
Deposited on 2005-08-11, released 2005-10-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.188
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasma kallikrein, light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: KLKB1, KLK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03952 (0-End)
      • engineered (5)
      • engineered (62)
      • engineered (103)
      • engineered (112)
    Domains in SCOPe 2.01: d2anya_
  • Heterogens: PO4, BAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2anyA (A:)
    ivggtesswgewpwqvslqvkltaqrhlcggslighqwvltaahcfdglplqdvwriysg
    ilelsditkdtpfsqikeiiihqnykvsegnhdialiklqapleytefqkpislpskgdt
    stiytncwvtgwgfskekgeiqnilqkvniplvtneecqkryqdykitqrmvcagykegg
    kdackgdsggplvckhngmwrlvgitswgegcarreqpgvytkvaeymdwilektqssdg
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >2anyA (A:)
    ivggtesswgewpwqvslqvkltaqrhlcggslighqwvltaahcfdglplqdvwriysg
    ilelsditkdtpfsqikeiiihqnykvsegnhdialiklqapleytefqkpislpskgdt
    stiytncwvtgwgfskekgeiqnilqkvniplvtneecqkryqdykitqrmvcagykegg
    kdackgdsggplvckhngmwrlvgitswgegcarreqpgvytkvaeymdwilektqss