PDB entry 2anu

View 2anu on RCSB PDB site
Description: Crystal structure of Predicted metal-dependent phosphoesterase (PHP family) (tm0559) from THERMOTOGA MARITIMA at 2.40 A resolution
Class: metal binding protein
Keywords: tm0559, Predicted metal-dependent phosphoesterase (PHP family), Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, METAL BINDING PROTEIN
Deposited on 2005-08-11, released 2005-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TM0559
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0559
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ29
      • modified residue (29)
      • modified residue (101)
      • modified residue (170)
      • modified residue (242)
    Domains in SCOPe 2.07: d2anua1
  • Chain 'B':
    Compound: hypothetical protein TM0559
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0559
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ29
      • modified residue (29)
      • modified residue (101)
      • modified residue (170)
      • modified residue (242)
    Domains in SCOPe 2.07: d2anub_
  • Chain 'C':
    Compound: hypothetical protein TM0559
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0559
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ29
      • modified residue (29)
      • modified residue (101)
      • modified residue (170)
      • modified residue (242)
    Domains in SCOPe 2.07: d2anuc_
  • Chain 'D':
    Compound: hypothetical protein TM0559
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0559
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ29
      • modified residue (29)
      • modified residue (101)
      • modified residue (170)
      • modified residue (242)
    Domains in SCOPe 2.07: d2anud_
  • Chain 'E':
    Compound: hypothetical protein TM0559
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0559
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ29
      • modified residue (29)
      • modified residue (101)
      • modified residue (170)
      • modified residue (242)
    Domains in SCOPe 2.07: d2anue_
  • Chain 'F':
    Compound: hypothetical protein TM0559
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0559
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ29
      • modified residue (29)
      • modified residue (101)
      • modified residue (170)
      • modified residue (242)
    Domains in SCOPe 2.07: d2anuf_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2anuA (A:)
    mgsdkihhhhhhmktdtewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivd
    rrtleqrkrngeplgaitedkfqdylkrlwreqkraweeygmilipgveitnntdlyhiv
    avdvkeyvdpslpveeiveklkeqnalviaahpdrkkqdeehlswylwanmerfkdtfda
    weianrddlfnsvgvkkyryvansdfhelwhvyswktlvkseknieaikeairkntdvai
    ylmrknrlsslsdvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2anuA (A:)
    tewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivdrrtleqrkrngeplga
    itedkfqdylkrlwreqkraweeygmilipgveitnntdlyhivavdvkeyvdpslpvee
    iveklkeqnalviaahpdrkklswylwanmerfkdtfdaweianrddlfnsvgvkkyryv
    ansdfhelwhvyswktlvkseknieaikeairkntdvaiylmrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2anuB (B:)
    mgsdkihhhhhhmktdtewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivd
    rrtleqrkrngeplgaitedkfqdylkrlwreqkraweeygmilipgveitnntdlyhiv
    avdvkeyvdpslpveeiveklkeqnalviaahpdrkkqdeehlswylwanmerfkdtfda
    weianrddlfnsvgvkkyryvansdfhelwhvyswktlvkseknieaikeairkntdvai
    ylmrknrlsslsdvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2anuB (B:)
    tewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivdrrtleqrkrngeplga
    itedkfqdylkrlwreqkraweeygmilipgveitnntdlyhivavdvkeyvdpslpvee
    iveklkeqnalviaahpdrkwylwanmerfkdtfdaweianrddlfnsvgvkkyryvans
    dfhelwhvyswktlvkseknieaikeairkntdvaiylmrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2anuC (C:)
    mgsdkihhhhhhmktdtewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivd
    rrtleqrkrngeplgaitedkfqdylkrlwreqkraweeygmilipgveitnntdlyhiv
    avdvkeyvdpslpveeiveklkeqnalviaahpdrkkqdeehlswylwanmerfkdtfda
    weianrddlfnsvgvkkyryvansdfhelwhvyswktlvkseknieaikeairkntdvai
    ylmrknrlsslsdvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2anuC (C:)
    tewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivdrrtleqrkrngeplga
    itedkfqdylkrlwreqkraweeygmilipgveitnntdlyhivavdvkeyvdpslpvee
    iveklkeqnalviaahpdrkkswylwanmerfkdtfdaweianrddlfnsvgvkkyryva
    nsdfhelwhvyswktlvkseknieaikeairkntdvaiylmr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2anuD (D:)
    mgsdkihhhhhhmktdtewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivd
    rrtleqrkrngeplgaitedkfqdylkrlwreqkraweeygmilipgveitnntdlyhiv
    avdvkeyvdpslpveeiveklkeqnalviaahpdrkkqdeehlswylwanmerfkdtfda
    weianrddlfnsvgvkkyryvansdfhelwhvyswktlvkseknieaikeairkntdvai
    ylmrknrlsslsdvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2anuD (D:)
    tewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivdrrtleqrkrngeplga
    itedkfqdylkrlwreqkraweeygmilipgveitnntdlyhivavdvkeyvdpslpvee
    iveklkeqnalviaahpdrkwylwanmerfkdtfdaweianrddlfnsvgvkkyryvans
    dfhelwhvyswktlvkseknieaikeairkntdvaiylmr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2anuE (E:)
    mgsdkihhhhhhmktdtewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivd
    rrtleqrkrngeplgaitedkfqdylkrlwreqkraweeygmilipgveitnntdlyhiv
    avdvkeyvdpslpveeiveklkeqnalviaahpdrkkqdeehlswylwanmerfkdtfda
    weianrddlfnsvgvkkyryvansdfhelwhvyswktlvkseknieaikeairkntdvai
    ylmrknrlsslsdvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2anuE (E:)
    tewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivdrrtleqrkrngeplga
    itedkfqdylkrlwreqkraweeygmilipgveitnntdlyhivavdvkeyvdpslpvee
    iveklkeqnalviaahpdrkhlswylwanmerfkdtfdaweianrddlfnsvgvkkyryv
    ansdfhelwhvyswktlvkseknieaikeairkntdvaiylmr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2anuF (F:)
    mgsdkihhhhhhmktdtewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivd
    rrtleqrkrngeplgaitedkfqdylkrlwreqkraweeygmilipgveitnntdlyhiv
    avdvkeyvdpslpveeiveklkeqnalviaahpdrkkqdeehlswylwanmerfkdtfda
    weianrddlfnsvgvkkyryvansdfhelwhvyswktlvkseknieaikeairkntdvai
    ylmrknrlsslsdvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2anuF (F:)
    tewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivdrrtleqrkrngeplga
    itedkfqdylkrlwreqkraweeygmilipgveitnntdlyhivavdvkeyvdpslpvee
    iveklkeqnalviaahpdrkhlswylwanmerfkdtfdaweianrddlfnsvgvkkyryv
    ansdfhelwhvyswktlvkseknieaikeairkntdvaiylmrk