PDB entry 2anj

View 2anj on RCSB PDB site
Description: Crystal Structure of the Glur2 Ligand Binding Core (S1S2J-Y450W) Mutant in Complex With the Partial Agonist Kainic Acid at 2.1 A Resolution
Class: membrane protein
Keywords: Ionotropic Glutamate Receptor, GluR2 Ligand-Binding Core, Agonist Complex, Mutant, MEMBRANE PROTEIN
Deposited on 2005-08-11, released 2005-08-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.187
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (2-116)
      • cloning artifact (0-1)
      • engineered (60)
      • see remark 999 (117-118)
    • Uniprot P19491 (119-End)
    Domains in SCOPe 2.06: d2anja1, d2anja2
  • Heterogens: KAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2anjA (A:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    wgardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2anjA (A:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    wgardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lneqglldklknkwwydkgecg