PDB entry 2anh

View 2anh on RCSB PDB site
Description: alkaline phosphatase (d153h)
Class: alkaline phosphatase
Keywords: hydrolase (phosphoric monoester), transferase (phospho, alcohol acceptor), alkaline phosphatase
Deposited on 1995-09-06, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.185
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (0-445)
      • engineered (149)
    Domains in SCOPe 2.07: d2anha_
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (0-445)
      • engineered (149)
    Domains in SCOPe 2.07: d2anhb_
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2anhA (A:)
    mpvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarn
    yaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvd
    ihekdhptilemakaaglatgnvstaelqhatpaalvahvtsrkcygpsatsekcpgnal
    ekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaasl
    nsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmt
    dkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntl
    vivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaayg
    phaanvvgltdqtdlfytmkaalglk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2anhB (B:)
    mpvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarn
    yaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvd
    ihekdhptilemakaaglatgnvstaelqhatpaalvahvtsrkcygpsatsekcpgnal
    ekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaasl
    nsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmt
    dkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntl
    vivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaayg
    phaanvvgltdqtdlfytmkaalglk