PDB entry 2ane

View 2ane on RCSB PDB site
Description: Crystal structure of N-terminal domain of E.Coli Lon Protease
Class: hydrolase
Keywords: lONn119, lON pROTEASE, Hydrolase
Deposited on 2005-08-11, released 2005-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent protease La
    Species: Escherichia coli [TaxId:562]
    Gene: lon, capR, deg, lopA, muc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2anea1
  • Chain 'B':
    Compound: ATP-dependent protease La
    Species: Escherichia coli [TaxId:562]
    Gene: lon, capR, deg, lopA, muc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2aneb_
  • Chain 'C':
    Compound: ATP-dependent protease La
    Species: Escherichia coli [TaxId:562]
    Gene: lon, capR, deg, lopA, muc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2anec_
  • Chain 'D':
    Compound: ATP-dependent protease La
    Species: Escherichia coli [TaxId:562]
    Gene: lon, capR, deg, lopA, muc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2aned_
  • Chain 'E':
    Compound: ATP-dependent protease La
    Species: Escherichia coli [TaxId:562]
    Gene: lon, capR, deg, lopA, muc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2anee_
  • Chain 'F':
    Compound: ATP-dependent protease La
    Species: Escherichia coli [TaxId:562]
    Gene: lon, capR, deg, lopA, muc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2anef_
  • Chain 'G':
    Compound: ATP-dependent protease La
    Species: Escherichia coli [TaxId:562]
    Gene: lon, capR, deg, lopA, muc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2aneg_
  • Chain 'H':
    Compound: ATP-dependent protease La
    Species: Escherichia coli [TaxId:562]
    Gene: lon, capR, deg, lopA, muc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2aneh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aneA (A:)
    mhhhhhhmnperserieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlv
    aqkeastdepgvndlftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsak
    aeyle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aneA (A:)
    rieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvnd
    lftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaeyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aneB (B:)
    mhhhhhhmnperserieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlv
    aqkeastdepgvndlftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsak
    aeyle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aneB (B:)
    eipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvndlf
    tvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaeyl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aneC (C:)
    mhhhhhhmnperserieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlv
    aqkeastdepgvndlftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsak
    aeyle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aneC (C:)
    eipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvndlf
    tvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaeyl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2aneD (D:)
    mhhhhhhmnperserieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlv
    aqkeastdepgvndlftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsak
    aeyle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aneD (D:)
    rieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvnd
    lftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaeyl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2aneE (E:)
    mhhhhhhmnperserieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlv
    aqkeastdepgvndlftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsak
    aeyle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aneE (E:)
    rieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvnd
    lftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaeyl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2aneF (F:)
    mhhhhhhmnperserieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlv
    aqkeastdepgvndlftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsak
    aeyle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aneF (F:)
    rieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvnd
    lftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaeyl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2aneG (G:)
    mhhhhhhmnperserieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlv
    aqkeastdepgvndlftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsak
    aeyle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aneG (G:)
    rieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvnd
    lftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaeyl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2aneH (H:)
    mhhhhhhmnperserieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlv
    aqkeastdepgvndlftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsak
    aeyle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aneH (H:)
    rieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvnd
    lftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaey