PDB entry 2anc

View 2anc on RCSB PDB site
Description: Crystal Structure Of Unliganded Form Of Oligomeric E.coli Guanylate Kinase
Class: transferase
Keywords: transferase, GMP kinase, guanylate kinase, oligomeric
Deposited on 2005-08-11, released 2005-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.257
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2anca1
  • Chain 'B':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ancb1
  • Chain 'C':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ancc1
  • Chain 'D':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ancd1
  • Chain 'E':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ance1
  • Chain 'F':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ancf1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ancA (A:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ancA (A:)
    aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
    fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
    filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt
    iiraerlrmsrqkqrhdalisklla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ancB (B:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ancB (B:)
    aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
    fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
    filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt
    iiraerlrmsrqkqrhdaliskll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ancC (C:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ancC (C:)
    aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
    fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
    filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt
    iiraerlrmsrqkqrhdalisklla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ancD (D:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ancD (D:)
    qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
    kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
    ilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkti
    iraerlrmsrqkqrhdalisklla
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ancE (E:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ancE (E:)
    aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
    fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
    filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt
    iiraerlrmsrqkqrhdaliskll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ancF (F:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ancF (F:)
    aqgtlyivsapsgagkssliqallktqplydtqeaieqvlatgvdvfldidwqgaqqirq
    kmpharsifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfd
    taltdlktiiraerlrmsrqkqrhdalisklla