PDB entry 2anb

View 2anb on RCSB PDB site
Description: Crystal Structure Of Oligomeric E.coli Guanylate Kinase In Complex With GMP
Class: transferase
Keywords: transferase, GMP kinase, guanylate kinase, oligomeric
Deposited on 2005-08-11, released 2005-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.205
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2anba_
  • Heterogens: SO4, 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2anbA (A:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2anbA (A:)
    aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
    fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
    filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt
    iiraerlrmsrqkqrhdaliskllad