PDB entry 2an9

View 2an9 on RCSB PDB site
Description: Crystal Structure Of Oligomeric E.coli Guanylate Kinase In Complex With GDP
Class: Transferase
Keywords: Transferase, GMP kinase, guanylate kinase, oligomeric
Deposited on 2005-08-11, released 2005-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.189
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2an9a_
  • Chain 'B':
    Compound: Guanylate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: gmk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2an9b_
  • Heterogens: K, GDP, GMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2an9A (A:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2an9A (A:)
    aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
    fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
    filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt
    iiraerlrmsrqkqrhdalisklla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2an9B (B:)
    maqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhd
    efkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmphars
    ifilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlk
    tiiraerlrmsrqkqrhdaliskllad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2an9B (B:)
    aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
    fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
    filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt
    iiraerlrmsrqkqrhdalisklla