PDB entry 2an6

View 2an6 on RCSB PDB site
Description: Protein-peptide complex
Class: ligase
Keywords: protein-peptide complex, LIGASE
Deposited on 2005-08-11, released 2006-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.241
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin ligase SIAH1A
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2an6a1
  • Chain 'B':
    Compound: Ubiquitin ligase SIAH1A
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2an6b1
  • Chain 'C':
    Compound: Ubiquitin ligase SIAH1A
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2an6c1
  • Chain 'D':
    Compound: Ubiquitin ligase SIAH1A
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2an6d1
  • Chain 'E':
    Compound: peptide from Phyllopod
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2AN6
  • Chain 'F':
    Compound: peptide from Phyllopod
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2AN6
  • Chain 'G':
    Compound: peptide from Phyllopod
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2AN6
  • Chain 'H':
    Compound: peptide from Phyllopod
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2AN6
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2an6A (A:)
    nsvlfpckyassgceitlphtekaeheelcefrpyscpcpgasckwqgsldavmphlmhq
    hksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivql
    igtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaeng
    nlginvtismc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2an6B (B:)
    nsvlfpckyassgceitlphtekaeheelcefrpyscpcpgasckwqgsldavmphlmhq
    hksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivql
    igtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaeng
    nlginvtismc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2an6C (C:)
    nsvlfpckyassgceitlphtekaeheelcefrpyscpcpgasckwqgsldavmphlmhq
    hksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivql
    igtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaeng
    nlginvtismc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2an6D (D:)
    nsvlfpckyassgceitlphtekaeheelcefrpyscpcpgasckwqgsldavmphlmhq
    hksittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivql
    igtrkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaeng
    nlginvtismc
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.