PDB entry 2amx

View 2amx on RCSB PDB site
Description: Crystal structure of Plasmodium Yoelii Adenosine deaminase (PY02076)
Class: hydrolase
Keywords: Plasmodium Yoelii Adenosine deaminase (PY02076), Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2005-08-10, released 2005-09-20
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine deaminase
    Species: Plasmodium yoelii
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7RMV2 (19-375)
      • cloning artifact (12-18)
    Domains in SCOP 1.73: d2amxa1
  • Chain 'B':
    Compound: adenosine deaminase
    Species: Plasmodium yoelii
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7RMV2 (19-375)
      • cloning artifact (12-18)
    Domains in SCOP 1.73: d2amxb1
  • Heterogens: CO, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2amxA (A:)
    mgsshhhhhhssglvprgseikflkkedvqnidlngmskkeryeiwrripkvelhchldl
    tfsaefflkwarkynlqpnmsddeildhylftkegkslaefirkaisvsdlyrdydfied
    lakwaviekykegvvlmefrysptfvsssygldvelihkafikgiknatellnnkihval
    icisdtghaaasikhsgdfaikhkhdfvgfdhggreidlkdhkdvyhsvrdhglhltvha
    gedatlpnlntlytainilnverighgirvsesdelielvkkkdillevcpisnlllnnv
    ksmdthpirklydagvkvsvnsddpgmflsnindnyeklyihlnftleefmimnnwafek
    sfvsddvkselkalyf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2amxA (A:)
    glvprgseikflkkedvqnidlngmskkeryeiwrripkvelhchldltfsaefflkwar
    kynlqpnmsddeildhylftkegkslaefirkaisvsdlyrdydfiedlakwaviekyke
    gvvlmefrysptfvsssygldvelihkafikgiknatellnnkihvalicisdtghaaas
    ikhsgdfaikhkhdfvgfdhggreidlkdhkdvyhsvrdhglhltvhagedatlpnlntl
    ytainilnverighgirvsesdelielvkkkdillevcpisnlllnnvksmdthpirkly
    dagvkvsvnsddpgmflsnindnyeklyihlnftleefmimnnwafeksfvsddvkselk
    alyf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2amxB (B:)
    mgsshhhhhhssglvprgseikflkkedvqnidlngmskkeryeiwrripkvelhchldl
    tfsaefflkwarkynlqpnmsddeildhylftkegkslaefirkaisvsdlyrdydfied
    lakwaviekykegvvlmefrysptfvsssygldvelihkafikgiknatellnnkihval
    icisdtghaaasikhsgdfaikhkhdfvgfdhggreidlkdhkdvyhsvrdhglhltvha
    gedatlpnlntlytainilnverighgirvsesdelielvkkkdillevcpisnlllnnv
    ksmdthpirklydagvkvsvnsddpgmflsnindnyeklyihlnftleefmimnnwafek
    sfvsddvkselkalyf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2amxB (B:)
    glvprgseikflkkedvqnidlngmskkeryeiwrripkvelhchldltfsaefflkwar
    kynlqpnmsddeildhylftkegkslaefirkaisvsdlyrdydfiedlakwaviekyke
    gvvlmefrysptfvsssygldvelihkafikgiknatellnnkihvalicisdkhsgdfa
    ikhkhdfvgfdhggreidlkdhkdvyhsvrdhglhltvhagedatlpnlntlytainiln
    verighgirvsesdelielvkkkdillevcpisnlllnnvksmdthpirklydagvkvsv
    nsddpgmflsnindnyeklyihlnftleefmimnnwafeksfvsddvkselkalyf