PDB entry 2amh

View 2amh on RCSB PDB site
Description: Crystal Structure of Maf-like Protein Tbru21784AAA from T.brucei
Class: structural genomics, unknown function
Keywords: 2 domain alpha-beta motif, Structural Genomics, PSI, Protein Structure Initiative, Structural Genomics of Pathogenic Protozoa Consortium, SGPP
Deposited on 2005-08-09, released 2005-08-16
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-16, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: septum formation protein MAF homologue, putative
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed):
    • GB EAN80372 (Start-206)
    Domains in SCOP 1.73: d2amha1
  • Heterogens: SO4, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2amhA (A:)
    gpgsmaeeirtmiigtssafranvlrehfgdrfrnfvllppdidekayraadpfeltesi
    arakmkavlekarqhsppisgpaialtfdqvvvkgdevrekplsteqcrsfiasysgggv
    rtvatyalcvvgtenvlvahnetetffskfgddivertlergacmnsagglvvededmsr
    hvvrivgtsygvrgmepavvekllsql
    

    Sequence, based on observed residues (ATOM records): (download)
    >2amhA (A:)
    eeirtmiigtssafranvlrehfgdrfrnfvllppdidekayraadpfeltesiarakmk
    avlekarqhpaialtfdqvvvkgdevrekplsteqcrsfiasysgggvrtvatyalcvvg
    tenvlvahnetetffskfgddivertlergacmnsagglvvededmsrhvvrivgtsygv
    rgmepavvekllsql