PDB entry 2amd

View 2amd on RCSB PDB site
Description: Crystal Structure Of SARS_CoV Mpro in Complex with an Inhibitor N9
Class: Hydrolase
Keywords: ANTI-PARALLEL B-BARREL, ANTI-PARALLEL A-HELICES, Hydrolase
Deposited on 2005-08-09, released 2005-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.215
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59641 (5-End)
      • cloning artifact (1-4)
    Domains in SCOPe 2.08: d2amda1, d2amda2
  • Chain 'B':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59641 (5-End)
      • cloning artifact (3-4)
    Domains in SCOPe 2.08: d2amdb1, d2amdb2
  • Heterogens: 9IN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2amdA (A:)
    gplgssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnye
    dllirksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvl
    acyngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagt
    dlegkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvam
    kynyepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfd
    vvrqcsgvtfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2amdA (A:)
    plgssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyed
    llirksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvla
    cyngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtd
    legkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamk
    ynyepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdv
    vrqcsgvtf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2amdB (B:)
    gplgssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnye
    dllirksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvl
    acyngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagt
    dlegkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvam
    kynyepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfd
    vvrqcsgvtfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2amdB (B:)
    gssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedll
    irksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacy
    ngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdle
    gkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkyn
    yepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvr
    qcsg