PDB entry 2amc

View 2amc on RCSB PDB site
Description: Crystal structure of Phenylalanyl-tRNA synthetase complexed with L-tyrosine
Class: ligase
Keywords: protein-amino acid complex, LIGASE
Deposited on 2005-08-09, released 2005-12-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.229
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylalanyl-tRNA synthetase alpha chain
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2amca_
  • Chain 'B':
    Compound: phenylalanyl-tRNA synthetase beta chain
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2amcb1, d2amcb2, d2amcb3, d2amcb4, d2amcb5, d2amcb6
  • Heterogens: MG, SO4, TYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2amcA (A:)
    rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
    ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
    feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
    aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
    lrygipdiryffggrlkfleqfkgvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2amcB (B:)
    mrvpfswlkayvpelespevleerlaglgfetdriervfpiprgvvfarvleahpipgtr
    lkrlvldagrtvevvsgaenarkgigvalalpgtelpglgqkvgerviqgvrsfgmalsp
    relgvgeygggllefpedalppgtplseawpeevvldlevtpnrpdalgllglardlhal
    gyalvepeaalkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmr
    pinnvvdvtnyvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlvi
    agwrgeesfplglagvmggaesevredteaialevacfdpvsirktarrhglrteashrf
    ergvdplgqvpaqrralsllqalagarvaealleagspkppeaipfrpeyanrllgtsyp
    eaeqiailkrlgcrvegegptyrvtppshrldlrleedlveevariqgyetiplalpaff
    papdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllllnplape
    kaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegvglpwak
    erlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflgalhpeia
    qelelppvhlfelrlplpdkplafqdpsrhpaafrdlavvvpaptpygevealvreaagp
    yleslalfdlyqgpplpeghkslafhlrfrhpkrtlrdeeveeavsrvaealrargfglr
    gldtp