PDB entry 2amb

View 2amb on RCSB PDB site
Description: Crystal structure of human androgen receptor ligand binding domain in complex with tetrahydrogestrinone
Class: Hormone/Growth Factor Receptor
Keywords: Nuclear Receptor, Androgen Receptor, Ligand Binding Domain, THG, Agonist, Designer Androgen, Hormone-Growth Factor Receptor COMPLEX
Deposited on 2005-08-09, released 2006-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.186
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AR, DHTR, NR3C4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2amba_
  • Heterogens: SO4, 17H, DTT, EPE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ambA (A:)
    ettqkltvshiegyecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlv
    hvvkwakalpgfrnlhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfney
    rmhksrmysqcvrmrhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmn
    yikeldriiackrknptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpe
    mmaeiisvqvpkilsgkvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ambA (A:)
    piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
    ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
    sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrtscs
    rrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkvkp
    iyfhtq