PDB entry 2alw

View 2alw on RCSB PDB site
Description: Golgi alpha-mannosidase II complex with Noeuromycin
Class: hydrolase
Keywords: glycosyl hydrolase family 38
Deposited on 2005-08-08, released 2006-07-04
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.141
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-mannosidase II
    Species: Drosophila melanogaster
    Gene: GmII
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q24451
      • variant (906)
    Domains in SCOP 1.73: d2alwa1, d2alwa2, d2alwa3
  • Heterogens: NAG, ZN, MNM, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2alwA (A:)
    rsshhhhhhgefddpirpplkvarsprpgqcqdvvqdvpnvdvqmlelydrmsfkdidgg
    vwkqgwnikydplkynahhklkvfvvphshndpgwiqtfeeyyqhdtkhilsnalrhlhd
    npemkfiwaeisyfarfyhdlgenkklqmksivkngqlefvtggwvmpdeanshwrnvll
    qltegqtwlkqfmnvtptaswaidpfghsptmpyilqksgfknmliqrthysvkkelaqq
    rqleflwrqiwdnkgdtalfthmmpfysydiphtcgpdpkvccqfdfkrmgsfglscpwk
    vpprtisdqnvaarsdllvdqwkkkaelyrtnvlliplgddfrfkqntewdvqrvnyerl
    fehinsqahfnvqaqfgtlqeyfdavhqaeragqaefptlsgdfftyadrsdnywsgyyt
    srpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhhdgitgtakt
    hvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfsyftlddsrwpgsgvedsr
    ttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtdlannpveaqvspvwswhh
    dtltktihpqgsttkyriifkarvppmglatyvltisdskpehtsyasnlllrknptslp
    lgqypedvkfgdpreislrvgngptlafseqgllksiqltqdsphvpvhfkflkygvrsh
    gdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglpsvvhqtimrggapeirnlv
    digsldnteivmrlethidsgdifytdlnglqfikrrrldklplqanyypipsgmfieda
    ntrltlltgqplggsslasgeleimqdrrlasdderglgqgvldnkpvlhiyrlvlekvn
    ncvrpsklhpagyltsaahkasqslldpldkfifaenewigaqgqfggdhpsaredldvs
    vmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchllpnvarcerttltflqnl
    ehldgmvapevcpmetaayvsshss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2alwA (A:)
    cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh
    ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk
    sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghsp
    tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd
    iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr
    tnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae
    ragqaefptlsgdfftyadrsdnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdg
    marieerleqarrelslfqhhdgitgtakthvvvdyeqrmqealkacqmvmqqsvyrllt
    kpsiyspdfsfsyftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvd
    fyvsspfvsvtdlannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmgla
    tyvltisdskpehtsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafse
    qgllksiqltqdsphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkg
    klessvsvglpsvvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlng
    lqfikrrrldklplqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrl
    asdderglgqgvldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpld
    kfifaenewigaqgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtp
    eehtqkldvchllpnvarcerttltflqnlehldgmvapevcpmetaayvsshs