PDB entry 2alu

View 2alu on RCSB PDB site
Description: Detection of new binding site in the C-terminal lobe of lactoferrin:Crystal structure of the complex formed between bovine lactoferrin and a tetrasaccharide at 2.1A resolution
Class: transport protein
Keywords: lactoferrin, complex, TRANSPORT PROTEIN
Deposited on 2005-08-08, released 2005-09-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactotransferrin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24627 (0-End)
      • engineered (223)
      • engineered (266)
    Domains in SCOPe 2.03: d2alua_
  • Heterogens: NAG, ZN, FE, CO3, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aluA (A:)
    ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
    agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
    drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
    kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
    teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
    ndnteclaklggrptyeeylgteyvtaianlkkcstsplleacafltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aluA (A:)
    ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
    agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
    drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
    kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
    teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
    ndnteclaklggrptyeeylgteyvtaianlkkcsleaca