PDB entry 2alm

View 2alm on RCSB PDB site
Description: Crystal structure analysis of a mutant beta-ketoacyl-[acyl carrier protein] synthase II from Streptococcus pneumoniae
Class: transferase
Keywords: Beta-ketoacyl-ACP synthase II, Thiolase
Deposited on 2005-08-07, released 2005-08-30
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-30, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.195
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-(acyl-carrier-protein) synthase II
    Species: Streptococcus pneumoniae
    Gene: fabF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FBC2 (20-428)
      • cloning artifact (17-19)
      • engineered (322)
      • engineered (398)
    Domains in SCOP 1.73: d2alma1, d2alma2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2almA (A:)
    mgsshhhhhhssglvprgshmklnrvvvtgygvtspigntpeefwnslatgkigiggitk
    fdhsdfdvhnaaeiqdfpfdkyfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdr
    fgvivasgiggikeiedqvlrlhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksi
    ntacsssndaigdafrsikfgfqdvmlvggteasitpfaiagfqaltalsttedptrasi
    pfdkdrngfvmgegsgmlvleslehaekrgatilaevvgygntcdayhmtsphpegqgai
    kaiklaleeaeispeqvayvnaagtstpanekgesgaivavlgkevpvsstksftghllg
    aagaveaivtieamrhnfvpmtagtsevsdyieanvvyaqglekeipyaisntfgfgghn
    avlafkrwenr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2almA (A:)
    gshmklnrvvvtgygvtspigntpeefwnslatgkigiggitkfdhsdfdvhnaaeiqdf
    pfdkyfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrfgvivasgiggikeied
    qvlrlhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrs
    ikfgfqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgm
    lvleslehaekrgatilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqv
    ayvnaagtstpanekgesgaivavlgkevpvsstksftghllgaagaveaivtieamrhn
    fvpmtagtsevsdyieanvvyaqglekeipyaisntfgfgghnavlafkrwe