PDB entry 2all

View 2all on RCSB PDB site
Description: Crystal structure of L122V/L132V mutant of nitrophorin 2
Class: Transport Protein
Keywords: beta barrel, lipocalin, ferric heme, double mutant, Transport Protein
Deposited on 2005-08-05, released 2006-07-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.139
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Nitrophorin 2
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26241 (1-179)
      • initiating methionine (0)
      • engineered (122)
      • engineered (132)
    Domains in SCOPe 2.08: d2allx_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2allX (X:)
    mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
    ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
    icvregskdlgdvytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl