PDB entry 2alg

View 2alg on RCSB PDB site
Description: Crystal structure of peach Pru p3, the prototypic member of the family of plant non-specific lipid transfer protein pan-allergens
Class: lipid transport
Keywords: Non-specific lipid transfer protein, LTP, ns-LTP, FOOD ALLERGEN, LIPID TRANSPORT
Deposited on 2005-08-05, released 2005-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-specific lipid transfer protein
    Species: Prunus persica [TaxId:3760]
    Gene: LTP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81402 (1-91)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d2alga_
  • Chain 'B':
    Compound: non-specific lipid transfer protein
    Species: Prunus persica [TaxId:3760]
    Gene: LTP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81402 (1-91)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d2algb_
  • Heterogens: SO4, DAO, HP6, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2algA (A:)
    mitcgqvssslapcipyvrgggavppaccngirnvnnlarttpdrqaacnclkqlsasvp
    gvnpnnaaalpgkcgvsipykisastncatvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2algB (B:)
    mitcgqvssslapcipyvrgggavppaccngirnvnnlarttpdrqaacnclkqlsasvp
    gvnpnnaaalpgkcgvsipykisastncatvk