PDB entry 2alg

View 2alg on RCSB PDB site
Description: Crystal structure of peach Pru p3, the prototypic member of the family of plant non-specific lipid transfer protein pan-allergens
Class: lipid transport
Keywords: Non-specific lipid transfer protein, LTP, ns-LTP, FOOD ALLERGEN, LIPID TRANSPORT
Deposited on 2005-08-05, released 2005-11-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: non-specific lipid transfer protein
  Species: Prunus persica [TaxId:3760]
  Gene: LTP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81402 (1-91)
    • initiating methionine (0)
  Domains in SCOPe 2.05: d2alga_
• Chain 'B':
  Compound: non-specific lipid transfer protein
  Species: Prunus persica [TaxId:3760]
  Gene: LTP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81402 (1-91)
    • initiating methionine (0)
  Domains in SCOPe 2.05: d2algb_
• Heterogens: SO4, DAO, HP6, P6G, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2algA (A:)
  mitcgqvssslapcipyvrgggavppaccngirnvnnlarttpdrqaacnclkqlsasvp
  gvnpnnaaalpgkcgvsipykisastncatvk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2algB (B:)
  mitcgqvssslapcipyvrgggavppaccngirnvnnlarttpdrqaacnclkqlsasvp
  gvnpnnaaalpgkcgvsipykisastncatvk