PDB entry 2alg
View 2alg on RCSB PDB site
Description: Crystal structure of peach Pru p3, the prototypic member of the family of plant non-specific lipid transfer protein pan-allergens
Class: lipid transport
Keywords: Non-specific lipid transfer protein, LTP, ns-LTP, FOOD ALLERGEN, LIPID TRANSPORT
Deposited on
2005-08-05, released
2005-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.36
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: non-specific lipid transfer protein
Species: Prunus persica [TaxId:3760]
Gene: LTP
Database cross-references and differences (RAF-indexed):
- Uniprot P81402 (1-91)
- initiating methionine (0)
Domains in SCOPe 2.08: d2alga_ - Chain 'B':
Compound: non-specific lipid transfer protein
Species: Prunus persica [TaxId:3760]
Gene: LTP
Database cross-references and differences (RAF-indexed):
- Uniprot P81402 (1-91)
- initiating methionine (0)
Domains in SCOPe 2.08: d2algb_ - Heterogens: SO4, DAO, HP6, P6G, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2algA (A:)
mitcgqvssslapcipyvrgggavppaccngirnvnnlarttpdrqaacnclkqlsasvp
gvnpnnaaalpgkcgvsipykisastncatvk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2algB (B:)
mitcgqvssslapcipyvrgggavppaccngirnvnnlarttpdrqaacnclkqlsasvp
gvnpnnaaalpgkcgvsipykisastncatvk