PDB entry 2alf

View 2alf on RCSB PDB site
Description: crystal structure of human CypA mutant K131A
Class: isomerase
Keywords: isomerase
Deposited on 2005-08-05, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-prolyl cis-trans isomerase A
  Species: Homo sapiens [TaxId:9606]
  Gene: CyPA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62937 (0-163)
    • conflict (118)
    • engineered (129)
  Domains in SCOPe 2.07: d2alfa1
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2alfA (A:)
  vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
  cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktkw
  ldgkhvvfgavkegmniveamerfgsrngktskkitiadcgqle