PDB entry 2alf

View 2alf on RCSB PDB site
Description: crystal structure of human CypA mutant K131A
Class: isomerase
Keywords: isomerase
Deposited on 2005-08-05, released 2005-08-23
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-23, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: HOMO SAPIENS
    Gene: CyPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62937 (0-163)
      • conflict (118)
      • engineered (129)
    Domains in SCOP 1.73: d2alfa1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2alfA (A:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktkw
    ldgkhvvfgavkegmniveamerfgsrngktskkitiadcgqle