PDB entry 2alc

View 2alc on RCSB PDB site
Description: ethanol regulon transcriptional activator dna-binding domain from aspergillus nidulans
Deposited on 1999-01-20, released 2000-01-21
The last revision prior to the SCOP 1.57 freeze date was dated 2000-02-14, with a file datestamp of 2000-02-14.
Experiment type: NMR1
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d2alca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2alcA (A:)
    gsmadtrrrqnhscdpcrkgkrrcdapenrneanengwvscsnckrwnkdctfnwlssqr
    sknss