PDB entry 2al7

View 2al7 on RCSB PDB site
Description: Structure Of Human ADP-Ribosylation Factor-Like 10C
Class: transport protein
Keywords: transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, sgc
Deposited on 2005-08-04, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-like 10C
    Species: Homo sapiens [TaxId:9606]
    Gene: ARL10C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NVJ2 (19-End)
      • cloning artifact (18)
    Domains in SCOPe 2.07: d2al7a1, d2al7a2
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2al7A (A:)
    mgsshhhhhhssglvprgskeemeltlvglqysgkttfvnviasgqfsedmiptvgfnmr
    kvtkgnvtikiwdiggqprfrsmwerycrgvnaivymidaadrekieasrnelhnlldkp
    qlqgipvlvlgnkrdlpnaldekqliekmnlsaiqdreiccysisckekdniditlqwli
    qhsksr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2al7A (A:)
    skeemeltlvglqysgkttfvnviavgfnmrkvtkgnvtikiwdiggqprfrsmwerycr
    gvnaivymidaadrekieasrnelhnlldkpqlqgipvlvlgnkrdlpnaldekqliekm
    nlsaiqdreiccysisckekdniditlqwliqhsk