PDB entry 2al6

View 2al6 on RCSB PDB site
Description: FERM domain of Focal Adhesion Kinase
Class: transferase
Keywords: Focal Adhesion Kinase FERM domain autophosphorylation site Src SH3 binding site, TRANSFERASE
Deposited on 2005-08-04, released 2005-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.215
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Gallus gallus [TaxId:9031]
    Gene: FAK1, FAK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2al6a1, d2al6a2, d2al6a3
  • Chain 'B':
    Compound: Focal adhesion kinase 1
    Species: Gallus gallus [TaxId:9031]
    Gene: FAK1, FAK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2al6b1, d2al6b2, d2al6b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2al6A (A:)
    gamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshl
    qseevhwlhldmgvsnvrekfelahppeewkyelrirylpkgflnqftedkptlnffyqq
    vkndymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglrrffpks
    lldsvkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiisv
    elaigpeegisyltdkganpthladfnqvqtiqysnsedkdrkgmlqlkiagapepltvt
    apsltiaenmadlidgycrlvngatqsfiirpqkegeralpsipklannekqgvrshtvs
    vsetddyaeiideed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2al6A (A:)
    gamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshl
    qseevhwlhldmgvsnvrekfelahppeewkyelrirylpkgflnqftedkptlnffyqq
    vkndymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglrrffpks
    lldsvkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiisv
    elaigpeegisyltdkganpthladfnqvqtiqysnsedkdrkgmlqlkiagapepltvt
    apsltiaenmadlidgycrlvngatqsfiirpqtddyaeiide
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2al6B (B:)
    gamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshl
    qseevhwlhldmgvsnvrekfelahppeewkyelrirylpkgflnqftedkptlnffyqq
    vkndymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglrrffpks
    lldsvkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiisv
    elaigpeegisyltdkganpthladfnqvqtiqysnsedkdrkgmlqlkiagapepltvt
    apsltiaenmadlidgycrlvngatqsfiirpqkegeralpsipklannekqgvrshtvs
    vsetddyaeiideed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2al6B (B:)
    mervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshlqs
    eevhwlhldmgvsnvrekfelahppeewkyelrirylpkgflnqftedkptlnffyqqvk
    ndymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglrrffpksll
    dsvkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiisvel
    aigpeegisyltdkganpthladfnqvqtiqysnsedkdrkgmlqlkiagapepltvtap
    sltiaenmadlidgycrlvngatqsfiirpqkegeralpsipktddyaeii