PDB entry 2al1

View 2al1 on RCSB PDB site
Description: Crystal Structure Analysis of Enolase Mg Subunit Complex at pH 8.0
Class: lyase
Keywords: beta barrel, lyase
Deposited on 2005-08-04, released 2006-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.153
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2al1a1, d2al1a2
  • Chain 'B':
    Compound: enolase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2al1b1, d2al1b2
  • Heterogens: MG, CL, K, PEP, 2PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2al1A (A:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    vkigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivaddltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2al1B (B:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggshaggalalqefmiaptgaktfa
    ealrigsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgk
    vkigldcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfae
    ddweawshffktagiqivaddltvtnpkriataiekkaadalllkvnqigtlsesikaaq
    dsfaagwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelg
    dnavfagenfhhgdkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2al1B (B:)
    avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
    vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
    aaaeknvplykhladlsksktspyvlpvpflnvlnggalalqefmiaptgaktfaealri
    gsevyhnlksltkkrygasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigl
    dcasseffkdgkydldfknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddwea
    wshffktagiqivaddltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaa
    gwgvmvshrsgetedtfiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavf
    agenfhhgdkl