PDB entry 2aky

View 2aky on RCSB PDB site
Description: high-resolution structures of adenylate kinase from yeast ligated with inhibitor ap5a, showing the pathway of phosphoryl transfer
Deposited on 1995-07-28, released 1995-11-14
The last revision prior to the SCOP 1.55 freeze date was dated 1995-11-14, with a file datestamp of 1995-11-15.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.176
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aky_ (-)
    esirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqggl
    vsddimvnmikdeltnnpackngfildgfprtipqaekldqmlkeqgtplekaielkvdd
    ellvaritgrlihpasgrsyhkifnppkedmkddvtgealvqrsddnadalkkrlaayha
    qtepivdfykktgiwagvdasqppatvwadilnklgkn