PDB entry 2akq

View 2akq on RCSB PDB site
Description: The structure of bovine B-lactoglobulin A in crystals grown at very low ionic strength
Class: transport protein
Keywords: B-lactoglbulin, X-RAY, crystal lattice, low ionic strength, pseudo-merohedral twinning
Deposited on 2005-08-03, released 2005-08-16
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.226
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactoglobulin variant A
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02754
      • see remark 999 (63)
      • see remark 999 (117)
    Domains in SCOP 1.73: d2akqa1
  • Chain 'B':
    Compound: Beta-lactoglobulin variant A
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02754
      • see remark 999 (63)
      • see remark 999 (117)
    Domains in SCOP 1.73: d2akqb1
  • Chain 'C':
    Compound: Beta-lactoglobulin variant A
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02754
      • see remark 999 (63)
      • see remark 999 (117)
    Domains in SCOP 1.73: d2akqc1
  • Chain 'D':
    Compound: Beta-lactoglobulin variant A
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02754
      • see remark 999 (63)
      • see remark 999 (117)
    Domains in SCOP 1.73: d2akqd1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2akqA (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2akqA (A:)
    qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwend
    ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcqclvr
    tpevddealekfdkalkalpmhirlsfnptqleeqc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2akqB (B:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2akqB (B:)
    qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwend
    ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcqclvr
    tpevddealekfdkalkalpmhirlsfnptqleeqc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2akqC (C:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2akqC (C:)
    qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwend
    ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcqclvr
    tpevddealekfdkalkalpmhirlsfnptqleeqc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2akqD (D:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2akqD (D:)
    qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwend
    ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcqclvr
    tpevddealekfdkalkalpmhirlsfnptqleeqc